Analytical Data
-
Gene name
NDUFS3
- Application
-
Alternative Names
NDUFS3;NADH dehydrogenase [ubiquinone] iron-sulfur Protein 3. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75489
-
Expression Region
37-264aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMESAGADTRPTVRPRNDVAHKQLSAFGEYV AEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANW YEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDE VKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFS3, a vital subunit of the mitochondrial respiratory chain complex I, plays a crucial role in cellular energy production via oxidative phosphorylation. Mutations in the NDUFS3 gene are associated with a range of mitochondrial disorders, leading to severe clinical manifestations including neurological deficits, muscle weakness, and multisystem complications. Understanding the structure and function of NDUFS3 is essential for elucidating the mechanisms underlying complex I's role in energy metabolism and its implications in various diseases. Recent studies have shown that NDUFS3 interacts with other subunits and cofactors, which are crucial for the assembly and stability of complex I. The recombinant production of NDUFS3 allows for detailed biochemical analyses, enabling researchers to investigate its functional properties, interactions, and regulatory mechanisms. Furthermore, studying NDUFS3 can provide insights into potential therapeutic strategies for treating mitochondrial dysfunctions, highlighting the significance of this protein in both basic research and clinical applications.
