Analytical Data
-
Gene name
AAV2gp07
- Application
-
Alternative Names
AAV2gp07；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A513ZUU9
-
Expression Region
1-533aa
-
AA Sequence
MATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTMSRLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTAADNNNSDYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKYFPQSGVLIFGKQDSGKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQSGNTQAATSDVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL
-
Molecular Weight
64.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AAV2gp07 is a recombinant protein derived from the adeno-associated virus (AAV), specifically tailored for gene therapy applications. AAVs are widely studied due to their safety profile and ability to deliver genetic material to a variety of cell types without causing pathogenic effects. The AAV2 serotype is particularly notable for its transduction efficiency in human cells. The gp07 variant incorporates specific modifications to enhance the viral capsid properties, improving its ability to bind to target cells and facilitate gene delivery. Research into AAV2gp07 focuses on its potential for therapeutic interventions in genetic disorders, where precise gene replacement or correction is critical. Studies have demonstrated its capability to overcome limitations associated with natural AAV vectors, such as immune recognition and tissue tropism. By employing advanced techniques like directed evolution and rational design, scientists aim to optimize AAV2gp07 for enhanced targeting, lower immunogenicity, and improved therapeutic outcomes. This progress is pivotal as it could lead to better treatment options for conditions such as inherited retinal diseases, muscular dystrophies, and other genetic disorders, thereby paving the way for the future of precision medicine and gene therapy.
