Cat: PA1000-2149

Recombinant Human NHP2L1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NHP2L1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNU13;NHP2L1;NHP2-like Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55769

  • Expression Region

    1-128aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLV QQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDK NVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL LV

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The NHP2L1 gene, located on chromosome 16, encodes a protein that is part of the NOP2/Sun RNA methyltransferase family, which has been implicated in various cellular processes, including ribosome biogenesis and RNA metabolism. Recent studies suggest that NHP2L1 may play a critical role in maintaining cellular homeostasis and regulating stress responses. Dysregulation of NHP2L1 has been associated with several diseases, including certain cancers and neurodegenerative disorders, highlighting its potential as a biomarker or therapeutic target. Given its importance in fundamental biological processes and disease pathways, the recombinant expression and characterization of the NHP2L1 protein have become a focus of research. Producing this protein in a recombinant system allows for detailed structural and functional analyses, enabling researchers to investigate its interactions with other cellular components, elucidate its role in disease, and explore its therapeutic potentials. Understanding the precise mechanisms of NHP2L1 function could provide insights into new strategies for disease intervention and pave the way for the development of novel therapeutic agents. Thus, the study of NHP2L1 recombinant protein holds significant promise for advancing our knowledge of cellular regulation and disease pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US