Analytical Data
-
Gene name
LSM14A
- Application
-
Alternative Names
AlphaSNBP; C19orf13 ; Chromosome 19 open reading frame 13 ; DKFZp434D1335; FAM61A; Family with sequence similarity 61 member A; hRAP55; hRAP55A; LS14A_HUMAN; LSM14 homolog A (SCD6 S cerevisiae); LSM14 homolog A; LSM14A; Protein FAM61A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8ND56
-
Expression Region
1-463aa
-
AA Sequence
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA
-
Molecular Weight
77 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of LSM14A, a member of the LSM (like Sm) protein family, has gained significant interest in recent years due to its pivotal role in RNA metabolism and gene regulation. LSM14A is primarily involved in the assembly of RNA-protein complexes and has been implicated in the regulation of mRNA stability and translation. Emerging evidence suggests that LSM14A is also a key player in stress granule formation, which is essential for cellular responses to environmental stressors. Dysregulation of this protein has been associated with various diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. Recent advances in molecular biology techniques have facilitated the generation and characterization of recombinant LSM14A, enabling the exploration of its structural and functional properties. Understanding the biochemical mechanisms underlying LSM14A's role in RNA metabolism could provide insights into novel regulatory pathways and therapeutic approaches for diseases linked to RNA dysregulation. Thus, research on LSM14A not only contributes to basic biological knowledge but also holds promise for translational applications in treating RNA-related pathologies.
