Analytical Data
-
Gene name
NREP
- Application
-
Alternative Names
NREP;C5orf13;P311;Neuronal regeneration-related Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16612
-
Expression Region
1-68aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMVYYPELFVWVSQEPFPNKDMEGRLPK GRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NREP (Neuron-Restrictive Silencer Factor/CCAAT Enhancer-Binding Protein-α-Related Protein) is a member of the CCAAT/enhancer-binding protein (C/EBP) family, which plays a crucial role in regulating gene expression during development and in various cellular processes. Its study has gained traction due to its significant implications in neurogenesis, cell differentiation, and potentially in the pathology of neurodegenerative diseases. Research indicates that NREP functions in a neuron-restrictive manner, influencing the maturation of neuronal cells and the expression of specific neuronal genes. Furthermore, the protein's involvement in the regulation of inflammatory responses and its potential link to metabolic disorders have added to its biological significance. Advances in recombinant protein technology have enabled the production of NREP for in-depth studies on its structural and functional properties, facilitating the exploration of its role in both health and disease. Given the increasing incidence of neurological disorders, understanding NREP's mechanisms could lead to innovative therapeutic strategies and provide insights into neuronal function and dysfunction. As a result, the comprehensive investigation of NREP at the molecular level remains a critical area of research, with the potential to uncover crucial pathways involved in neuronal health and disease.
