Analytical Data
-
Gene name
EphA6
-
简介
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA6 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphA6 at 2 μg/mL(100 μL/well) can bind biotinylated recombinant mouse EphrinA3. The ED50 for this effect is 42.95 ng/mL. Measured by its binding ability in a functional ELISA.Immobilized recombinant mouse EphA6 at 2 μg/mL (100 μL/well) can bind biotinylated recombinant mouse EphrinA3 .The ED50 for this effect is 42.95 ng/mL.
-
Alternative Names
Ephrin type-A receptor 6; EPH homology kinase 2; EHK-2; Epha6
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q62413
-
Expression Region
W23-Q546
-
AA Sequence
WTGDCSHVSNQVVLLDTTTVMGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYIESDESHGTKFKPSQYIKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSSTYVEATSVCHCEKGYFRAEKDPPSMACTRPPSAPRNVAFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTTQCEDCGGGLRFIPRHTGLINNSVVVLDFVSHVNYTFEIEAMNGVSELSISPKPFTAITVTTDHDAPSLIGMMRKDWASQNSLALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIVTGLKPATTYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQ
-
Protein Length
Extracellular Domain
-
Molecular Weight
65-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EphA6 is a member of the Eph receptor tyrosine kinase family, which plays crucial roles in various biological processes, including cell adhesion, migration, and involvement in neural development. The EphA6 receptor has gained attention due to its unique expression patterns in the brain and its potential implications in neurodevelopmental disorders and tumors. Research on EphA6 recombinant protein has intensified to elucidate its structural and functional properties, which could provide insights into its signaling mechanisms and biological roles. By studying EphA6 in vitro, researchers aim to understand its interactions with Ephrin ligands and other cellular pathways that may influence neuronal connectivity and plasticity. Furthermore, the recombinant form of this protein facilitates the development of therapeutic approaches targeting EphA6 pathways, offering potential avenues for treating conditions linked to its dysregulation. Overall, the investigation of EphA6 recombinant protein is essential for advancing our understanding of its roles in health and disease, paving the way for novel interventions in neurobiology and oncology.
