Cat: PA2000-4931

Recombinant Human H2BC12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    H2BC12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    H2BC12;H2BFT;HIRIP1;HIST1H2BK;Histone H2B type 1-K

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60814

  • Expression Region

    2-126aa

  • AA Sequence

    PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

  • Molecular Weight

    21.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

H2BC12, a member of the histone H2B family, has garnered attention in research due to its potential roles in chromatin structure, gene regulation, and cellular processes. Histone proteins play crucial roles in DNA wrapping and organization within the nucleus, influencing gene expression and the overall cell cycle. H2BC12, specifically, has been linked to various epigenetic modifications that are essential for DNA repair, replication, and the maintenance of genome stability. Its distinctive expression patterns in different tissues and its involvement in cellular differentiation highlight its significance in developmental biology and pathology. Recent studies have suggested that alterations in H2BC12 expression may correlate with certain diseases, including cancer, where dysregulation of histone proteins can lead to aberrant gene expression profiles. Consequently, understanding the function and mechanism of H2BC12 could provide insights into fundamental biological processes and potential therapeutic targets for disease intervention. Research on H2BC12 seeks to elucidate its structure-function relationships, post-translational modifications, and interactions with other nuclear proteins, aiming to comprehensively map its impact on cellular homeostasis and disease progression. This growing body of knowledge may eventually enable the development of novel strategies for manipulating gene expression and addressing various medical conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US