Analytical Data
-
Gene name
POLa1
- Application
-
Alternative Names
POLa1;POLA;DNA polymerase alpha catalytic subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09884
-
Expression Region
1363-1462aa
-
AA Sequence
QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POLa1, the catalytic subunit of DNA polymerase alpha, plays a critical role in DNA replication and repair processes. This enzyme is responsible for initiating DNA synthesis by synthesizing short RNA-DNA primers, which are essential for the elongation of DNA strands. Research into POLa1 has gained momentum due to its implications in various diseases, including cancer, where its overexpression is often linked to tumor development and progression. Additionally, POLa1 interacts with several other proteins involved in the DNA damage response, highlighting its significance in maintaining genomic stability. Understanding the structure and function of POLa1 can provide insights into the molecular mechanisms underpinning these processes. Recent studies have focused on the development of POLa1 inhibitors as potential therapeutic agents, aiming to target its activity in cancer cells. Moreover, the exploration of POLa1's role in the aging process and age-related diseases is becoming an area of keen interest, as alterations in its function may contribute to cellular senescence and the accumulation of genetic damage over time. Overall, research on POLa1 is pivotal for advancing our understanding of DNA metabolism and developing novel strategies for cancer treatment and other related disorders.











