Cat: PA1000-2224

Recombinant Human NUDT9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NUDT9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NUDT9;NUDT10;ADP-ribose pyrophosphatase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BW91

  • Expression Region

    47-350aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMNTNVMSGSNGSKENSHNKARTSPYPGSKV ERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFN EKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPII TRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISA TLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNT DNAWMETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHS QFIKLVAEKRDAHWSEDSEADCHAL

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NUDT9, a member of the Nudix hydrolase family, has garnered significant research interest due to its role in various biochemical processes, particularly in the hydrolysis of nucleotide substrates. Initially identified in the context of cellular metabolism, NUDT9 is known to hydrolyze Nucleotide Diphosphate Sugars, playing a crucial role in regulating nucleotide levels and cellular signaling pathways. Its importance is underscored by the potential implications of NUDT9 dysfunction in various diseases, including cancer and metabolic disorders. Additionally, advancements in recombinant protein technology have facilitated the production and purification of NUDT9, allowing researchers to delve deeper into its structural and functional properties. Understanding the enzymatic mechanisms and substrate specificity of NUDT9 not only contributes to basic biochemistry but also opens avenues for therapeutic interventions that target nucleotide metabolism. With the continuous exploration of nucleoside analogs and their interactions with NUDT9, this research holds promise in drug development and the design of novel therapeutic strategies. As such, the study of NUDT9 recombinant protein is pivotal in elucidating its biological roles and potential implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US