Analytical Data
-
Gene name
MAGEC1
- Application
-
Alternative Names
Cancer/testis antigen 7.1; Cancer/testis antigen family 7 member 1; CT7; CT7.1; MAGC1_HUMAN; MAGE C1; MAGE C1 antigen; MAGE-C1 antigen; MAGEC1; melanoma antigen family C. 1; Melanoma associated antigen C1; Melanoma-associated antigen C1; MGC39366
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60732
-
Expression Region
1-139aa
-
AA Sequence
MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYPLQSPQSRSEGEDSSDPLQRPPEGKDSQSPLQIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSA
-
Molecular Weight
40.92 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGEC1, a member of the MAGE (Melanoma Antigen Gene) family, is a cancer/testis antigen predominantly expressed in various malignancies and highly present in testicular germ cells. Its role as a potential target for cancer immunotherapy has garnered significant attention in recent years. MAGEC1 is characterized by its ability to elicit an immune response, making it an attractive candidate for developing vaccines and adoptive T cell therapies. Research has indicated that MAGEC1 is differentially expressed in tumor tissues compared to normal tissues, which enhances its appeal as a biomarker for cancer diagnosis and prognosis. Additionally, studies demonstrate that MAGEC1 can interact with key proteins involved in tumor development and progression, suggesting a potential role in oncogenic pathways. Investigating MAGEC1's molecular mechanisms, expression patterns, and immune characteristics is crucial for advancing personalized cancer therapies. By harnessing the immunogenic properties of MAGEC1, researchers aim to design targeted treatment strategies that could improve patient outcomes and promote long-lasting anti-tumor immunity. The exploration of MAGEC1 not only furthers our understanding of tumor biology but also holds promise for innovative therapeutic applications against various cancers.
