Cat: PA2000-9149

Recombinant Human MAGEC1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAGEC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cancer/testis antigen 7.1; Cancer/testis antigen family 7 member 1; CT7; CT7.1; MAGC1_HUMAN; MAGE C1; MAGE C1 antigen; MAGE-C1 antigen; MAGEC1; melanoma antigen family C. 1; Melanoma associated antigen C1; Melanoma-associated antigen C1; MGC39366

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60732

  • Expression Region

    1-139aa

  • AA Sequence

    MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYPLQSPQSRSEGEDSSDPLQRPPEGKDSQSPLQIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSA

  • Molecular Weight

    40.92 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAGEC1, a member of the MAGE (Melanoma Antigen Gene) family, is a cancer/testis antigen predominantly expressed in various malignancies and highly present in testicular germ cells. Its role as a potential target for cancer immunotherapy has garnered significant attention in recent years. MAGEC1 is characterized by its ability to elicit an immune response, making it an attractive candidate for developing vaccines and adoptive T cell therapies. Research has indicated that MAGEC1 is differentially expressed in tumor tissues compared to normal tissues, which enhances its appeal as a biomarker for cancer diagnosis and prognosis. Additionally, studies demonstrate that MAGEC1 can interact with key proteins involved in tumor development and progression, suggesting a potential role in oncogenic pathways. Investigating MAGEC1's molecular mechanisms, expression patterns, and immune characteristics is crucial for advancing personalized cancer therapies. By harnessing the immunogenic properties of MAGEC1, researchers aim to design targeted treatment strategies that could improve patient outcomes and promote long-lasting anti-tumor immunity. The exploration of MAGEC1 not only furthers our understanding of tumor biology but also holds promise for innovative therapeutic applications against various cancers.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US