Analytical Data
-
Gene name
CCRL2
- Application
-
Alternative Names
CCRL2；CCR11；CCR6；CKRX；C-C chemokine receptor-like 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00421
-
Expression Region
1-344aa
-
AA Sequence
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
-
Molecular Weight
45.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCRL2, or Chemokine Chemokine Receptor-Like 2, is a receptor belonging to the G protein-coupled receptor family, which plays a crucial role in immune system regulation and inflammation. As a chemokine receptor, CCRL2 is involved in the recruitment and activation of immune cells in response to various stimuli. Research into CCRL2 has gained momentum due to its potential implications in several pathological conditions, including autoimmune diseases, cancer, and infectious diseases. In particular, the expression of CCRL2 in different immune cell populations and its role in modulating immune responses have garnered attention, as it may offer new insights into therapeutic targets for immunological disorders. The study of CCRL2 recombinant proteins is pivotal in elucidating its functional mechanisms and signaling pathways. By producing CCRL2 as a recombinant protein, researchers aim to investigate its ligand-binding capabilities, the effects of receptor activation on downstream signaling, and its interactions with other cellular components. These studies not only contribute to the fundamental understanding of CCRL2's role in immune responses but also provide a foundation for developing targeted therapies that could modulate immune activity in various diseases. Furthermore, the recombinant CCRL2 protein can serve as a valuable tool for high-throughput screening of potential drugs that might influence its function. As such, the ongoing research surrounding CCRL2 is poised to significantly advance the field of immunology and therapeutic development, potentially leading to innovative strategies for managing inflammation and immune-related disorders.
