Analytical Data
-
Gene name
SDS
- Application
-
Alternative Names
SDS；SAP45；SDS3；Sin3 histone deacetylase corepressor complex component SDS3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20132
-
Expression Region
1-328aa
-
AA Sequence
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SDS (Sodium Dodecyl Sulfate) recombinant proteins are a crucial area of biotechnology research, primarily due to their applications in studying protein interactions, structures, and functions. The use of SDS in protein electrophoresis facilitates the separation of proteins based on their molecular weight, enabling researchers to analyze protein purity and characteristics effectively. The ability to produce recombinant proteins using bacterial, yeast, or mammalian expression systems has revolutionized the field, allowing for large-scale production of proteins that are difficult to obtain from natural sources. This technology aids in the study of disease mechanisms, the development of new therapeutic agents, and the production of protein-based vaccines. Furthermore, the manipulation of SDS to create hybrid proteins or tags enhances our understanding of protein folding, stability, and functionality. With advancements in genetic engineering, SDS recombinant proteins have become invaluable in drug discovery, diagnostic tools, and industrial applications, highlighting the significance of this research in both fundamental science and practical applications. The ongoing exploration of SDS recombinant proteins continues to address various scientific challenges, paving the way for innovations in health and biotechnology.
