Analytical Data
-
Gene name
MAP6D1
- Application
-
Alternative Names
MAP6D1; MAP6 domain-containing protein 1; 21 kDa STOP-like protein; SL21
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H9H5
-
Expression Region
1-199aa
-
AA Sequence
MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQRDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV
-
Molecular Weight
47.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP6D1 (Microtubule-Associated Protein 6 Domain 1) is a member of the MAP6 family, which plays a crucial role in stabilizing microtubules and regulating neuronal morphology. It has garnered attention due to its potential involvement in neurodevelopmental and psychiatric disorders. The human MAP6D1 gene, located on chromosome 4, encodes a protein that is predominantly expressed in the brain, suggesting its importance in neural function and connectivity. Recent studies have indicated that dysregulation of MAP6D1 may contribute to neurodegeneration and cognitive impairments, making it a significant target for therapeutic intervention. As a result, researchers have focused on the functional characterization of the MAP6D1 protein, including its interactions with microtubules and other cellular components. The development of recombinant MAP6D1 protein allows for the exploration of its biochemical properties and cellular effects, facilitating a better understanding of its role in neuronal health and disease. Ongoing studies aim to elucidate the signaling pathways influenced by MAP6D1 and its potential as a biomarker for neuropsychiatric conditions. Overall, this research is essential for developing novel strategies to target MAP6D1-related pathways in the context of brain disorders, ultimately contributing to the advancement of neurotherapeutics.
