Analytical Data
-
Gene name
GJA5
- Application
-
Alternative Names
GJA5；Gap junction alpha-5 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36382
-
Expression Region
1-358aa
-
AA Sequence
MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
-
Molecular Weight
41.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GJA5, a gene encoding the gap junction protein connexin 40, plays a crucial role in cellular communication, particularly in the cardiovascular system. Its expression is primarily observed in the heart, where it facilitates intercellular electrical coupling, impacting cardiac conduction and rhythm. Dysregulation or mutations in GJA5 have been linked to various cardiac disorders, including atrial fibrillation and other arrhythmias, making it a significant target for cardiovascular research. The study of GJA5 recombinant proteins is particularly important for understanding the molecular mechanisms underlying these conditions. By generating and analyzing GJA5 recombinant proteins, researchers can investigate the protein's structure, function, and interaction with other cellular components. This research can provide insights into the role of GJA5 in normal and pathological cardiac physiology, paving the way for potential therapeutic strategies targeting gap junction communication. Moreover, exploring the post-translational modifications and functional states of GJA5 can shed light on how environmental factors and genetic variations impact its activity, further advancing our understanding of heart health and disease.
