Analytical Data
-
Gene name
SYN2
- Application
-
Alternative Names
SYN2；Synapsin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92777
-
Expression Region
348-448aa
-
AA Sequence
AMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGE HQVEDRQLITELVISKMNQLLSRTPALSPQRPLTTQQPQSGTLKDPDSSK T
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYN2, or Synaptotagmin-2, is a protein that plays a crucial role in synaptic transmission and neurotransmitter release at presynaptic sites in neurons. Historically, the study of SYN2 has gained prominence due to its involvement in fast synaptic signaling, acting as a calcium sensor that triggers neurotransmitter vesicle fusion upon calcium influx. Research indicates that SYN2 is essential for the rapid and reliable release of neurotransmitters, influencing various physiological and behavioral processes. Abnormalities in SYN2 function have been linked to neurological disorders, such as autism spectrum disorders and schizophrenia, highlighting its potential as a therapeutic target. Recent advances in recombinant protein technology have facilitated the production and purification of SYN2, enabling detailed studies of its structure and function. Researchers aim to elucidate the mechanisms underlying SYN2's role in synaptic glutamate release, as well as its interactions with other proteins involved in synaptic vesicle dynamics. Understanding these pathways at a molecular level is critical for developing targeted interventions for synaptic dysfunction-related disorders. This research not only enhances our knowledge of synaptic biology but also contributes to the broader field of neuropharmacology by identifying potential biomarkers and therapeutic strategies for treating various cognitive and neurodevelopmental disorders.
