Analytical Data
-
Gene name
PTPN22
- Application
-
Alternative Names
PTPN22；Protein-tyrosine-phosphatase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2R2
-
Expression Region
1-179aa
-
AA Sequence
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAE KPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYI ATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTL KVKFNSVSVILAHQTSLQNLFSQITPAHF
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPN22, or protein tyrosine phosphatase non-receptor type 22, is a negative regulator of T cell activation and has emerged as a critical player in autoimmunity and various diseases. Its main function is to negatively regulate signaling pathways that promote T cell activation, thereby maintaining immune tolerance. Dysregulation or mutations in the PTPN22 gene have been strongly associated with autoimmune diseases, such as rheumatoid arthritis, type 1 diabetes, and systemic lupus erythematosus. This has spurred significant interest in understanding the molecular mechanisms of PTPN22's action. The study of PTPN22 recombinant proteins allows researchers to explore its structure-function relationships, investigate its interactions with other signaling molecules, and assess its role in immune cell signaling pathways. Furthermore, recombinant PTPN22 proteins can be utilized in therapeutic applications, including the development of targeted therapies for autoimmune diseases. Insights gained from these studies may not only enhance our knowledge of the immune system but also pave the way for novel therapeutic strategies to modulate immune responses in various pathological conditions.
