Cat: PA1000-2406

Recombinant Human PKIb Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PKIb

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PKIB;PRKACN2;cAMP-dependent Protein kinase inhibitor beta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9C010

  • Expression Region

    1-98aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNAL PDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

  • Molecular Weight

    11 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PKIb (Protein Kinase B, isoform beta) recombinant proteins has gained significant attention due to their crucial role in cellular signaling pathways, particularly in the regulation of metabolism, cell proliferation, and survival. PKIb, a member of the Akt family of serine/threonine kinases, is activated in response to various growth factors and is pivotal in mediating insulin signaling. The understanding of its biological function is essential, as dysregulation of PKIb has been implicated in various diseases, including cancer and metabolic disorders. Researchers have focused on developing recombinant PKIb proteins to elucidate their specific mechanisms of action and to facilitate structure-function analysis. These recombinant proteins serve as valuable tools for studying phosphorylation events, protein-protein interactions, and cellular responses to therapeutic agents. Furthermore, the production of PKIb recombinant proteins allows for in vitro assays and high-throughput screening of potential inhibitors, which can lead to the development of novel treatments. As a result, the investigation into PKIb recombinant proteins is not only important for basic biological research but also holds promise for clinical applications in combating diseases linked to PKIb dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US