Analytical Data
-
Gene name
PIEZO1
- Application
-
Alternative Names
PIEZO1;FAM38A;KIAA0233;Piezo-type mechanosensitive ion channel component 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92508
-
Expression Region
2198-2431aa
-
AA Sequence
RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS
-
Molecular Weight
33.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIEZO1 is a mechanically activated ion channel that plays a crucial role in various physiological processes, including mechanotransduction, cellular signaling, and blood pressure regulation. As a member of the PIEZO family, PIEZO1 has garnered attention due to its involvement in mechanosensation in diverse cell types, such as endothelial cells, red blood cells, and sensory neurons. Mutations or dysregulation of PIEZO1 are linked to several pathologies, including hereditary xerocytosis and associated hemolytic anemia, thus highlighting its importance in human health. Given its significance, the recombinant expression and characterization of PIEZO1 are essential for understanding its structure-function relationship. Research on PIEZO1 recombinant protein aims to elucidate its biophysical properties, ion conductance mechanisms, and interactions with other cellular components. These studies provide insights into how PIEZO1 transduces mechanical stimuli into biochemical signals, offering potential therapeutic targets for diseases associated with mechanotransduction dysfunction. The advancement of techniques in protein expression systems, coupled with innovative biophysical methods, allows for in-depth investigations of PIEZO1's dynamics and function, paving the way for future drug discovery and therapeutic interventions. Overall, the study of PIEZO1 recombinant protein is vital for comprehensively understanding its role in both normal physiology and disease states, ultimately contributing to the development of new strategies for treating mechanotransduction-related disorders.











