Analytical Data
-
Gene name
DHX36
- Application
-
Alternative Names
DHX36;DDX36;KIAA1488;MLEL1;ATP-dependent DNA/RNA helicase DHX36
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2U1
-
Expression Region
89-179aa
-
AA Sequence
ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DHX36, also known as DExH-box helicase 36, is an important member of the DExH/D family of RNA helicases and has been implicated in various cellular processes, including RNA metabolism and the regulation of gene expression. Research has shown that DHX36 plays a crucial role in unwinding RNA structures, particularly during the splicing and translation of mRNA. Its involvement in critical biological pathways, such as the immune response and the resolution of RNA stress granules, highlights its potential significance in both normal physiology and disease states. Dysregulation or mutations in DHX36 have been linked to several pathological conditions, including neurodegenerative diseases and certain cancers. Therefore, the recombinant expression and purification of DHX36 are essential for in-depth functional studies. By studying the structure and biochemical properties of this protein, researchers aim to uncover its specific roles in RNA processing and its interactions with other cellular components. Understanding DHX36's mechanisms may provide insights into therapeutic targets for diseases associated with RNA dysregulation, making it a significant focus of molecular biology and biomedical research.











