Analytical Data
-
Gene name
Tmem106b
- Application
-
Alternative Names
Tmem106b；Transmembrane Protein 106B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUM4
-
Expression Region
120-254aa
-
AA Sequence
SIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCG
-
Molecular Weight
17.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tmem106b, a transmembrane protein belonging to the TMEM family, has garnered significant attention in neurodegenerative research, particularly in the context of frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS). Genetic studies have identified variations in the TMEM106B gene as a risk factor for these diseases, suggesting its involvement in cellular processes crucial for neuronal health. The protein is thought to be associated with lysosomal function and autophagy, impacting the degradation and recycling of cellular components. Abnormalities in these pathways can lead to the accumulation of toxic proteins, contributing to neurodegeneration. Researchers are particularly interested in producing recombinant Tmem106b protein to better understand its structure, function, and interactions within the cellular environment. By exploring its role in cellular mechanisms and its potential pathogenic effects in neurodegenerative conditions, scientists hope to unveil new targets for therapeutic intervention. This research aims to elucidate how Tmem106b influences neuronal survival and the overall pathophysiology of FTD and ALS, providing insights that could enhance strategies for prevention and treatment of these debilitating disorders.
