Cat: PA2000-9411

Recombinant Human MOGAT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MOGAT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MOGAT3; DC7; DGAT2L7; UNQ9383/PRO34208; 2-acylglycerol O-acyltransferase 3; Acyl-CoA:monoacylglycerol acyltransferase 3; MGAT3; Diacylglycerol O-acyltransferase candidate 7; hDC7; Diacylglycerol acyltransferase 2-like protein 7; Monoacylglycerol O-acyltransferase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86VF5

  • Expression Region

    1-341 aa

  • AA Sequence

    MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRL KAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI

  • Molecular Weight

    38.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MOGAT3 (monoacylglycerol O-acyltransferase 3) is an important enzyme involved in lipid metabolism, specifically in the synthesis of diacylglycerol (DAG) from monoacylglycerols. Research on MOGAT3 has gained traction due to its potential implications in metabolic disorders, obesity, and cardiovascular diseases. As a critical player in the endocannabinoid system, MOGAT3 regulates the levels of 2-arachidonoylglycerol (2-AG), a lipid mediator with roles in neuronal signaling and inflammation. Increased MOGAT3 activity has been linked to heightened 2-AG levels, which can influence various physiological processes and contribute to the pathogenesis of several conditions, including diabetes and neurodegenerative diseases. The exploration of MOGAT3 as a therapeutic target is of great interest, as modulating its activity may offer new avenues for treatment. The development of recombinant MOGAT3 proteins allows for in-depth biochemical studies, enabling researchers to characterize its enzymatic properties and substrate specificity. Additionally, understanding the structure-function relationship of MOGAT3 through recombinant techniques can aid in the design of selective inhibitors, potentially leading to novel strategies for managing metabolic diseases. Overall, the study of MOGAT3 not only enhances our understanding of lipid metabolism but also opens potential therapeutic interventions for challenging health issues related to metabolic dysfunctions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US