Cat: PA1000-2544

Recombinant Human PSG1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSG1;B1G1;PSBG1;PSGGA;Pregnancy-specific beta-1-glycoProtein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11464

  • Expression Region

    35-426aa

  • AA Sequence

    QVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDLYHYITSYVV DGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGV TGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNG QSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLN LLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSP RVRRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDL PRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHI TTKHSGLYVCSVRNSATGKESSKSMTVEVSGKWIPASLAIGF

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSG1, or Placental-Specific Gene 1, is a member of the PSG gene family known for its expression in the placenta and its association with various physiological roles during pregnancy. The gene is primarily studied for its potential immunomodulatory functions, as it appears to play a significant role in modulating maternal immune responses to ensure fetal tolerance. Research suggests that PSG1 may influence the behavior of immune cells, such as macrophages and T cells, which is crucial for maintaining the delicate balance between the maternal and fetal immune systems. Additionally, PSG1 has been implicated in various pathological conditions, including pregnancy-related complications and certain cancers, making it a protein of interest for further investigation. Its unique expression profile and potential therapeutic implications have prompted studies focused on elucidating its structure, function, and mechanisms of action. Understanding PSG1 at a molecular level can contribute to the development of novel diagnostic and therapeutic strategies for pregnancy-related issues, as well as broader applications in immune regulation and cancer therapy. Overall, PSG1 represents a compelling target for research within both reproductive biology and immunology, highlighting the intricate connections between immune function and reproductive health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US