Analytical Data
-
Gene name
SLC25A39
- Application
-
Alternative Names
SLC25A39；Mitochondrial glutathione transporter SLC25A39
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZJ4
-
Expression Region
1-359aa
-
AA Sequence
MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLSYTKLPSSLQSTGKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVKTQRQVALGAMEAVRVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQDRLLGG
-
Molecular Weight
39.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A39, a member of the solute carrier family 25, plays a crucial role in mitochondrial transport processes, particularly in the transport of various metabolites across the mitochondrial membrane. This protein has been implicated in key cellular functions, including energy metabolism and the regulation of mitochondrial biogenesis. Recent studies have highlighted its importance in maintaining cellular homeostasis and its potential involvement in various diseases, such as neurodegenerative disorders and metabolic syndromes. Research into the recombinant form of SLC25A39 is essential for understanding its structural and functional properties, as well as its interactions with other mitochondrial proteins and potential substrates. By expressing and purifying SLC25A39 in a recombinant system, scientists aim to elucidate its transport mechanisms, assess its substrate specificity, and investigate the physiological roles it plays in human health. This knowledge may provide insight into the underlying causes of diseases related to mitochondrial dysfunction and pave the way for new therapeutic strategies targeting this protein. The ongoing exploration of SLC25A39 and its recombinant analysis could thus contribute significantly to the fields of cell biology, biochemistry, and medical research.
