Analytical Data
-
Gene name
PTP4A1
- Application
-
Alternative Names
PTP4A1;PRL1;PTPCAAX1;Protein tyrosine phosphatase type IVA 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q93096
-
Expression Region
1-170aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMARMNRPAPVEVTYKNMRFLITHNPTNATL NKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQI VDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAV QFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNC
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTP4A1, also known as protein tyrosine phosphatase 4A1, is part of a small family of tyrosine phosphatases that play crucial roles in various cellular processes, including cell growth, differentiation, and signaling pathways. Research has shown that PTP4A1 is overexpressed in several types of cancer, including breast, colorectal, and gastric cancers, indicating its potential role in tumor development and progression. Its enzymatic activity is associated with the dephosphorylation of tyrosine residues on target proteins, which can influence oncogenic signaling pathways such as those mediated by growth factors. Given its involvement in cancer biology, PTP4A1 has emerged as a promising target for therapeutic intervention. The study of its recombinant protein form facilitates the understanding of its enzymatic mechanism, interaction with substrates, and the identification of potential inhibitors. Structural analyses, alongside biochemical characterization, can elucidate the functional aspects of PTP4A1 and its role in malignant transformation. By exploring its expression patterns and functional implications, researchers aim to unravel its contribution to cancer pathology and develop novel strategies for diagnosis and treatment, potentially leveraging PTP4A1 as a biomarker for cancer progression or as a target for drug development. Overall, the investigation of PTP4A1 recombinant protein is critical for advancing our knowledge of its biological functions and therapeutic potential in oncology.
