Analytical Data
-
Gene name
EIF3M
- Application
-
Alternative Names
EIF3M;HFLB5;PCID1;Eukaryotic translation initiation factor 3 subunit M
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L2H7
-
Expression Region
2-374aa
-
AA Sequence
SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDV CLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSL RLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWI SDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQAR VDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLAS YVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQEL QIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLY DTLNAWKQNLNKVKNSLLSLSDT
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF3M is a crucial component of the eukaryotic translation initiation factor eIF3, which plays a significant role in the regulation of protein synthesis. It is involved in the assembly of the ribosomal complex and the recruitment of the mRNA and initiator tRNA, thereby facilitating the initiation of translation. The study of EIF3M is particularly important due to its implications in various biological processes and diseases, including cancer. Abnormal expression levels of EIF3M have been linked to tumorigenesis, making it a potential biomarker for cancer diagnosis and prognosis. Furthermore, EIF3M's interactions with other cellular factors suggest its involvement in cellular signaling pathways and stress responses. Given its essential functions and association with critical health issues, the recombinant expression and characterization of EIF3M could provide valuable insights into its biological roles and mechanisms. This research not only enhances our understanding of the translation initiation process but also opens avenues for therapeutic interventions targeting EIF3M-related pathways in diseases. By producing a stable recombinant form of EIF3M, researchers can investigate its structural properties, functional interactions, and potential as a target for drug development, emphasizing the importance of this protein in both fundamental biology and clinical applications. This study aims to elucidate the multifaceted roles of EIF3M, paving the way for future research and potential clinical applications in oncology and molecular biology.











