Cat: PA2000-9575

Recombinant Human MYST3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MYST3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HAT 3; Histone acetyltransferase MYST3; Monocytic leukemia zinc finger protein; MOZ; MOZ. YBF2/SAS3. SAS2 and TIP60 protein 3; MYST histone acetyltransferase (monocytic leukemia) 3; MYST protein 3; MYST-3; MYST3; MYST3_HUMAN; OTTHUMP00000197392; OTTHUMP00000197394; OTTHUMP00000225722; Runt related transcription factor binding protein 2; Runt-related transcription factor-binding protein 2; RUNXBP2 ; SAS2 ; SAS2 and TIP60 protein 3; TIP60 protein 3; YBF2/SAS3; ZC2HC6A; Zinc finger protein 220; ZNF220

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92794

  • Expression Region

    81-179  aa

  • AA Sequence

    ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK

  • Molecular Weight

    36.63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MYST3, a member of the MYST family of histone acetyltransferases, plays a crucial role in the regulation of gene expression through its enzymatic activity, which adds acetyl groups to histone proteins, thereby influencing chromatin dynamics and accessibility. Recent studies have illuminated the significance of MYST3 in diverse biological processes, including cell proliferation, differentiation, and apoptosis, making it a key player in various cancers and developmental disorders. The investigation of MYST3 recombinant proteins has emerged as a vital approach to understanding its functional mechanisms and interactions within the cellular context. By producing MYST3 in a recombinant form, researchers can perform in-depth analyses of its catalytic properties, binding interactions, and substrate specificity. Moreover, such studies can unravel the pathways through which MYST3 contributes to oncogenesis, providing potential targets for therapeutic intervention. Given the pressing need for targeted cancer therapies, the characterization of MYST3 and its associated complexes holds promise for identifying novel strategies to combat malignancies driven by epigenetic dysregulation. Thus, the research on MYST3 recombinant proteins not only enhances our understanding of its biological roles but also opens avenues for innovative treatments in cancer and other diseases linked to aberrant acetylation processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US