Analytical Data
-
Gene name
CCL6
- Application
-
Alternative Names
CCL6；C10；Scya6；C-C motif chemokine 6
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27784
-
Expression Region
1-116aa
-
AA Sequence
MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL6, a member of the CC chemokine family, is a small cytokine that plays a significant role in immune response regulation, particularly in the recruitment and activation of immune cells. Recent studies have highlighted its potential involvement in various diseases, including infections, autoimmune disorders, and cancer. Given its critical functions, CCL6 has garnered attention as a promising target for therapeutic interventions. Research into recombinant CCL6 protein aims to elucidate its biological functions, signaling pathways, and interaction with specific receptors on immune cells. Furthermore, the production of recombinant CCL6 allows for systematic studies of its effects in vitro and in vivo, facilitating the exploration of its role in modulating inflammatory responses and cellular behaviors. By understanding the mechanisms underlying CCL6's effects on immune cell dynamics, researchers hope to develop novel strategies for treating diseases characterized by immune dysregulation. Moreover, the potential to utilize CCL6 in designing immunotherapeutic approaches or as a biomarker for disease progression underscores its relevance in biomedical research. As investigations continue, recombinant CCL6 protein is poised to contribute vital insights into the complex interplay of chemokines in health and disease.
