Analytical Data
-
Gene name
ORNT1
- Application
-
Alternative Names
ORNT1；ORC1；ORNT1；Mitochondrial ornithine transporter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y619
-
Expression Region
1-301aa
-
AA Sequence
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY
-
Molecular Weight
59.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ORNT1, or Oxidized Reduced Nicotinamide Adenine Dinucleotide Transporter 1, is a mitochondrial transporter that plays a crucial role in cellular metabolism. It is implicated in the transport of oxidized NAD and serves as a key component in maintaining the balance of NAD+/NADH ratios in mitochondria, which is essential for various metabolic processes, including energy production and apoptosis. Research has shown that ORNT1 is involved in the regulation of cellular redox states and may influence the pathophysiology of various diseases, including cancer, neurodegenerative disorders, and metabolic syndromes. The interest in ORNT1 recombinant protein arises from its potential as a therapeutic target, as well as its utility in understanding mitochondrial dysfunction. Studies have focused on the characterization of ORNT1's structural properties and functional mechanisms, using recombinant protein expression techniques to produce ORNT1 in heterologous systems. Investigating ORNT1 can provide valuable insights into mitochondrial dynamics and its implications for human health, paving the way for novel therapeutic interventions aimed at restoring mitochondrial function and metabolic homeostasis.
