Analytical Data
-
Gene name
RPS10
- Application
-
Alternative Names
RPS10;Small ribosomal subunit Protein eS10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46783
-
Expression Region
1-165aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLMPKKNRIAIYELLFKEGVMVAKKDV HMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQ YLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTY RRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPS10, a component of the ribosomal protein family, plays a critical role in the biogenesis of ribosomes and protein synthesis within cells. Ribosomal proteins, including RPS10, are essential for the assembly of ribosomal RNA and ribosomal subunits, which are crucial for translating messenger RNA into proteins. Recent studies have highlighted the significance of RPS10 in various cellular processes, including cell growth, proliferation, and stress responses. The dysregulation of ribosomal proteins, including RPS10, has been linked to several diseases, including cancer, where altered ribosomal function can contribute to uncontrolled cell proliferation. Research efforts have focused on the characterization of RPS10 through recombinant protein expression and purification techniques, allowing for in-depth studies of its structure, function, and interactions with other ribosomal components and regulatory factors. Understanding the precise role of RPS10 in ribosome assembly and function may unveil new therapeutic targets for diseases associated with ribosomal dysfunction. This research aims to elucidate the mechanisms by which RPS10 contributes to ribosome integrity and overall cellular homeostasis, providing insights into its broader implications in health and disease.











