Cat: PA1000-2902

Recombinant Human SFRP5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SFRP5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SFRP5;FRP1B;SARP3;Secreted frizzled-related Protein 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5T4F7

  • Expression Region

    30-317aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEEYDYYGWQAEPLHGRSYSKPPQCLDI PADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQV FLCSLFAPVCLDRPIYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFP LDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKM RIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKNGAGCPCP QLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYPCSLY YPFFYGAAEPH

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SFRP5 (Secreted Frizzled-Related Protein 5) is a member of the SFRP family, which acts as an antagonist to the Wnt signaling pathway. This pathway plays a crucial role in various developmental processes and its dysregulation is associated with numerous diseases, including cancer and metabolic disorders. SFRP5 has garnered attention for its potential role in modulating inflammation and insulin sensitivity, making it a target of interest in obesity and diabetes research. Recent studies have suggested that SFRP5 may influence adipocyte function and fatty acid metabolism, and its levels are altered in conditions such as obesity and cardiovascular diseases. The recombinant protein form of SFRP5 is of particular interest for research, as it allows for detailed studies on its structural and functional properties. Understanding how SFRP5 interacts with other components of the Wnt pathway and its downstream effects could provide insights into therapeutic interventions for related diseases. Furthermore, characterizing the role of SFRP5 in different biological contexts could enhance our understanding of its potential as a biomarker or therapeutic target. Overall, the exploration of SFRP5 and its recombinant forms represents a promising avenue for investigating the complex interplay between cellular signaling pathways and disease entities.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US