Cat: PA1000-2905

Recombinant Human SGCB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SGCB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SGCB;Beta-sarcoglycan

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16585

  • Expression Region

    1-318aa

  • AA Sequence

    MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDED RLHKTGLRGRKGNLAICVIILLFILAVINLIITLVIWAVIRIGPNGCDSM EFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGT TKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNV QKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELK AENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQV TSQNMGCQISDNPCGNTH

  • Molecular Weight

    61 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SGCB (Sarcoglycan Beta) is a member of the sarcoglycan complex, which plays a crucial role in the structural integrity and function of muscle tissue. Research into SGCB has gained significant attention due to its association with various forms of muscular dystrophy, particularly limb-girdle muscular dystrophy type 2E (LGMD2E). Mutations in the SGCB gene can lead to the destabilization of the dystrophin-associated protein complex, resulting in muscle fiber damage and progressive muscle weakness. Understanding the molecular mechanisms underlying SGCB dysfunction is essential for identifying potential therapeutic strategies. Recent advances in gene therapy, protein replacement, and CRISPR-Cas9 technology have opened new avenues for addressing SGCB-related muscle disorders. Investigating the structure-function relationship of SGCB, its interactions with other components of the sarcoglycan complex, and its role in muscle cell signaling pathways can provide insights into the pathophysiology of muscular dystrophies. Additionally, animal models and patient-derived cell lines are being increasingly utilized to study SGCB's function and the impact of specific mutations, facilitating the development of targeted treatments. Therefore, ongoing research into SGCB not only enhances our understanding of muscle biology but also holds promise for innovative therapeutic interventions in muscle degenerative diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US