Cat: PA1000-2932

Recombinant Human SIRT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SIRT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SIRT3;SIR2L3;NAD-dependent Protein deacetylase sirtuin-3. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NTG7

  • Expression Region

    118-399aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGA GISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERV SGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGV VKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRS SVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDL VQRETGKLDGPDK

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SIRT3, a member of the sirtuin family of proteins, is a mitochondrial deacetylase that plays a crucial role in cellular metabolism and stress response. Research on SIRT3 has gained momentum due to its involvement in various physiological processes, including regulation of mitochondrial function, oxidative stress response, and control of energy metabolism. Malfunctions in SIRT3 have been linked to several age-related diseases, such as obesity, diabetes, and neurodegenerative disorders. The ability of SIRT3 to deacetylate key metabolic enzymes emphasizes its potential as a therapeutic target for metabolic syndromes. Additionally, SIRT3 has been implicated in the modulation of mitochondrial dynamics and apoptosis, further underscoring its significance in maintaining cellular homeostasis. The recombinant protein form of SIRT3 enables detailed mechanistic studies, allowing researchers to dissect its enzymatic functions and interactions with various substrates. Understanding the structural and functional characteristics of recombinant SIRT3 can provide insights into its regulatory mechanisms and facilitate the development of SIRT3-targeted therapies. Thus, ongoing research into SIRT3 is pivotal for uncovering its therapeutic potential in the prevention and treatment of metabolic and age-associated diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US