Cat: PA2000-9930

Recombinant Human OR3A4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR3A4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR3A4P; OR3A4; OR3A5P; Putative olfactory receptor 3A4; Olfactory receptor 17-24; OR17-24; Olfactory receptor 3A5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47883

  • Expression Region

    1-348 aa

  • AA Sequence

    MDLGNSGNDSVVTKFVLLGLTETAALQPILFVIFLLAYVTTIGGTLSILAAILMETKLHS PMYFFLGNLSLPDVGCVSVTVPAMLSHFISNDRSIPYKACLSELFFFHLLAGADCFLLTI MAYDRYLAICQSLTYSSRMSWGIQQALVGMSCVFSFTNALTQTVALSPLNFCGPNVINHF YCDLPQPFQLSCSSVHLNGQLLFVAAAFMGVAPLVLITVSYAHVAAAVLRIRSAEGRKKA FSTCSSHLTVVGIFYGTGVFSYTRLGSVESSDKDKGIGILNTVISPMLNPLIYWTSLLDV GCISHCSSDAGVSPGPPVQSSLCCLQFTALLSPPPGWGGLSPLNSHGL

  • Molecular Weight

    37.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The cytochrome P450 enzyme CYP3A4 plays a crucial role in drug metabolism, influencing the pharmacokinetics of numerous medications. This enzyme is responsible for the oxidative metabolism of approximately 50% of drugs currently in use, making it essential for the biotransformation process in the liver. Variability in CYP3A4 expression and activity due to genetic polymorphisms, environmental factors such as diet and co-administered drugs, or diseases can significantly affect individual responses to medications, leading to therapeutic failure or adverse drug reactions. The production of recombinant CYP3A4 proteins has emerged as a valuable tool for pharmacological research, allowing for the investigation of drug-enzyme interactions, the effects of inhibitors and inducers, and the elucidation of metabolic pathways. Characterizing the recombinant protein provides insights into its catalytic mechanisms, substrate specificity, and regulation. Furthermore, the ability to produce large quantities of purified CYP3A4 facilitates high-throughput screening assays for drug discovery, enabling the identification of new therapeutic agents and the optimization of drug formulations. With the growing focus on personalized medicine, understanding the functional characteristics of CYP3A4 through recombinant technology is critical for predicting drug responses, minimizing adverse effects, and improving overall patient care.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US