Analytical Data
-
Gene name
ORMDL3
- Application
-
Alternative Names
ORMDL3; ORM1-like protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N138
-
Expression Region
1-153 aa
-
AA Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY
-
Molecular Weight
17.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ORMDL3, a member of the ORM-related protein family, has garnered significant interest in recent years due to its association with various inflammatory and autoimmune diseases. Initial studies identified ORMDL3 as a critical regulator of airway inflammation, particularly in asthma, where genetic polymorphisms in the ORMDL3 gene have been linked to increased susceptibility. The protein is thought to influence the endoplasmic reticulum stress response and modulate the production of pro-inflammatory cytokines. Furthermore, ORMDL3's role in the regulation of sphingolipid metabolism suggests a connection to cellular signaling pathways that are pivotal in immune responses. Recent research has focused on dissecting the molecular mechanisms underlying ORMDL3's influence on inflammation and its potential as a therapeutic target. Investigating the recombinant form of ORMDL3 allows for a more detailed understanding of its functional properties and interactions with other proteins involved in inflammatory pathways. As scholars continue to uncover the complexities of ORMDL3’s role in disease, its potential for therapeutic intervention could open new avenues for treating asthma and related conditions.
