Analytical Data
-
Gene name
NGFRAP1
- Application
-
Alternative Names
NGFRAP1；NADE2；NGFRAP1L1；Protein BEX5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00994
-
Expression Region
1-111aa
-
AA Sequence
MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NGFRAP1, or Nerve Growth Factor Receptor-Associated Protein 1, is a protein that has garnered attention in recent years due to its role in neuronal signaling and potential involvement in neurodegenerative diseases. Research indicates that NGFRAP1 is closely associated with the nerve growth factor (NGF) signaling pathway, which is crucial for the survival and maintenance of neurons. This connection suggests that variations in NGFRAP1 expression or function may contribute to the pathology of disorders such as Alzheimer’s disease and other neurodegenerative conditions. Scientists have sought to produce recombinant NGFRAP1 proteins to study their structure and function, allowing for a better understanding of their biological roles. The expression of NGFRAP1 as a recombinant protein is particularly valuable for biochemical assays, providing insights into its interactions with NGF and other signaling molecules, as well as its potential impact on neuronal health. Furthermore, examining the protein’s post-translational modifications and cellular localization can elucidate its functional mechanisms. Through these studies, researchers aim to determine whether targeting NGFRAP1 could offer new therapeutic avenues for neurodegenerative diseases by modulating NGF signaling and enhancing neuronal resilience. Thus, the exploration of NGFRAP1 not only contributes to our understanding of basic neurobiology but also opens up potential pathways for innovative treatments in neurology.
