Analytical Data
-
Gene name
PACRG
- Application
-
Alternative Names
FLJ32724; GLUP; HAK005771; Molecular chaperone/chaperonin binding protein; Molecular chaperone/chaperonin-binding protein; PACRG; PACRG_HUMAN; PARK 2 co regulated; PARK 2 coregulated; PARK2 co regulated; PARK2 coregulated; PARK2 coregulated gene protein; PARK2CRG; Parkin co regulated gene; Parkin co regulated gene protein; Parkin coregulated gene; Parkin coregulated gene protein; RP3 495O10.2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96M98
-
Expression Region
1-257 aa
-
AA Sequence
MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAG AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMT FPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAE MVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENA FINIKYVVPTYESCLLN
-
Molecular Weight
33.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PACRG (Parkinsonism Associated Protein, Regulator of G-protein Signaling) is a protein that has garnered significant interest in the field of neurobiology due to its association with Parkinson's disease and its role in regulating G-protein signaling pathways. Dysregulation of these pathways is implicated in various neurological disorders, making PACRG a potential target for therapeutic interventions. Recent studies have suggested that PACRG may influence cellular processes such as apoptosis, stress response, and neuroinflammation, which are crucial in the pathogenesis of neurodegenerative conditions. The recombinant expression of PACRG protein allows researchers to investigate its structure-function relationship, post-translational modifications, and interactions with other proteins. Understanding these aspects could illuminate the mechanisms by which PACRG contributes to neurodegeneration and its potential as a biomarker or therapeutic target. By developing a reliable method for producing and purifying PACRG, scientists aim to facilitate further studies that could ultimately lead to novel treatments for Parkinson's disease and related disorders. This research is vital as it may help bridge the gap between basic science and clinical applications, leveraging PACRG's role in cellular signaling to combat the debilitating effects of neurodegenerative diseases.
