Analytical Data
-
Gene name
TRAPPC4
- Application
-
Alternative Names
TRAPPC4；SBDN；Trafficking Protein particle complex subunit 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y296
-
Expression Region
1-219aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAIFSVYVVNKAGGLIYQLDSYAPRAE AEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTA DGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSP EQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIY SDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRAPPC4 is a member of the TRAPPII complex, which plays a crucial role in the intracellular transport and Golgi dynamics within eukaryotic cells. Research on TRAPPC4 has gained prominence due to its implications in various cellular processes, including vesicle formation, membrane trafficking, and organelle communication. Mutations in the TRAPPC4 gene have been associated with neurological disorders, thereby highlighting its importance in maintaining cellular homeostasis and function. Additionally, TRAPPC4 is thought to interact with other proteins involved in signaling pathways, further underscoring its potential role in regulating cellular responses. Understanding the structure and function of the TRAPPC4 protein, especially in its recombinant form, is essential for elucidating its mechanisms of action and potential involvement in disease. This research not only provides insights into fundamental cellular processes but also opens avenues for developing targeted therapies for conditions linked to TRAPPC4 dysfunction.
