Analytical Data
-
Gene name
TNNC2
- Application
-
Alternative Names
TNNC2；Troponin C. skeletal muscle
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02585
-
Expression Region
1-160aa
-
AA Sequence
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
-
Molecular Weight
45.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNNC2, or troponin C type 2, is a critical component of the troponin complex, which plays a vital role in the regulation of cardiac and skeletal muscle contraction. It binds calcium ions, initiating a cascade of events that lead to muscle contraction by interacting with tropomyosin and other troponin subunits. Given its essential function in muscle physiology, TNNC2 has garnered significant attention in cardiovascular research, particularly in the context of heart diseases. Mutations in the TNNC2 gene have been associated with familial forms of hypertrophic cardiomyopathy and other cardiac dysfunctions, making it a key target for genetic studies and therapeutic interventions. The recombinant protein of TNNC2 is produced for various applications, including investigating its structural and functional properties, studying the effects of specific mutations, and exploring its potential as a biomarker for cardiac diseases. Understanding the biophysical characteristics of TNNC2 through reconstitution into functional complexes allows researchers to elucidate the mechanisms underlying muscle contraction and the pathological changes that occur in the presence of genetic mutations. Therefore, the study of TNNC2 recombinant protein not only enhances our knowledge of muscle biology but also holds promise for developing novel diagnostic and therapeutic strategies for cardiac disorders.
