Analytical Data
-
Gene name
Adiponectin/Acrp30
-
简介
Adiponectin/Acrp30 Protein is a protein hormone and adipokine, the most abundant peptide secreted by adipocytes, which is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin plays a inportant role in obesity-related diseases, insulin resistance/type 2 diabetes and cardiovascular disease. Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Adiponectin/Acrp30 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
ACDC; Acrp30; ADPN; Adiponectin; AdipoQ; ADIPQTL1; APM1APM-1; GBP28; GBP28apM1; APM-1; APM1
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q60994
-
Expression Region
E18-N247
-
AA Sequence
EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
52-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Adiponectin, also known as Acrp30, is a peptide hormone secreted by adipocytes that plays a crucial role in metabolic processes, including insulin sensitivity, glucose regulation, and fatty acid oxidation. Its anti-inflammatory and insulin-sensitizing properties have drawn significant interest in the context of obesity, type 2 diabetes, and cardiovascular diseases. Research has shown that lower levels of adiponectin are associated with obesity-related complications, making it a potential biomarker for metabolic disorders. Recombinant adiponectin/Acrp30 protein has been developed to explore its therapeutic potential in treating metabolic syndromes. Studies investigating the functional aspects of this protein have highlighted its ability to enhance the metabolic profile, improve insulin sensitivity, and reduce inflammation in various animal models. Furthermore, recombinant adiponectin holds promise for clinical applications, including the treatment of insulin-resistant states and obesity-related conditions. As researchers continue to elucidate the mechanisms behind adiponectin's actions, the development and optimization of recombinant forms of this protein may pave the way for novel therapeutic strategies aimed at combating metabolic diseases and improving overall metabolic health.











