Analytical Data
-
Gene name
PIK4CB
- Application
-
Alternative Names
DKFZp686O1820; FLJ30129; NPIK; Phosphatidylinositol 4 kinase beta; Phosphatidylinositol 4 kinase catalytic beta; Phosphatidylinositol 4 kinase catalytic beta polypeptide; Phosphatidylinositol 4 kinase wortmannin sensitive; Phosphatidylinositol 4-kinase beta; PI4K BETA; PI4K-beta; PI4K92; PI4KB; PI4KB_HUMAN; PI4Kbeta; PI4KIIIbeta; PIK4CB; PtdIns 4 kinase; PtdIns 4-kinase beta; Type III phosphatidylinositol 4 kinase beta
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBF8
-
Expression Region
731-828 aa
-
AA Sequence
GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIK4CB, or phosphoinositide 4-kinase beta, is a pivotal enzyme involved in the synthesis of phosphatidylinositol 4-phosphate, a key lipid that participates in various cellular signaling pathways. Recent studies have emphasized its role in regulating intracellular processes such as vesicle trafficking, cytoskeletal organization, and cell growth. Dysregulation of PIK4CB has been linked to various diseases, including cancer, where its altered expression can affect tumor progression and metastasis. The study of recombinant PIK4CB protein is crucial for elucidating its functional mechanisms and interactions within cellular environments. By producing this protein in a laboratory setting, researchers can conduct structural and biochemical analyses, allowing for a deeper understanding of its activity and potential as a therapeutic target. Moreover, recombinant PIK4CB can be utilized to screen for small molecules or inhibitors that may modulate its function, offering new avenues for drug development. Overall, research on PIK4CB and its recombinant protein is fundamental for uncovering novel insights into cell signaling and disease mechanisms, ultimately contributing to the advancement of targeted therapies in oncology and other related fields.
