Analytical Data
-
Gene name
BFAR
- Application
-
Alternative Names
BFAR; BAR; RNF47; Bifunctional apoptosis regulator; RING finger Protein 47
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZS9
-
Expression Region
1-450aa
-
AA Sequence
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCNCLFYWALYFNPIINIDLVVKELRRLETQVL
-
Molecular Weight
79.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of BFAR (Bcl-2 family antagonist of cell death, also known as Bcl-2 family apoptotic regulator) recombinant proteins has gained significant attention in recent years due to their essential role in apoptosis, a critical process for maintaining cellular homeostasis and development. BFAR is a member of the Bcl-2 protein family, which is well-known for regulating cell survival and death pathways, influencing various biological functions and disease states, including cancer, neurodegeneration, and autoimmune disorders. Research has demonstrated that BFAR can counteract the pro-apoptotic signals, thus presenting it as a potential therapeutic target for interventions in diseases where apoptosis plays a pivotal role. The production of recombinant BFAR proteins allows for detailed investigations into their structure-function relationships, interactions with other cellular proteins, and their mechanisms of action in apoptosis regulation. Advances in biotechnology, particularly in protein expression and purification techniques, facilitate the generation of high-quality recombinant BFAR, enabling comprehensive studies that could lead to the development of novel therapeutic strategies aimed at modulating apoptosis in various pathological conditions. The exploration of BFAR's functions and its potential as a drug target holds promise for devising innovative treatments that could improve patient outcomes in diseases characterized by dysregulated cell death.
