Cat: PA1000-3815

Recombinant Human Cd300a Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cd300a

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cd300a;CMRF35H;CMRF35-like molecule 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UGN4

  • Expression Region

    18-178aa

  • AA Sequence

    LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGS AGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPV VEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASI QEETEEVVNSQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GKHHHHHH

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD300a, a member of the CD300 gene family, is an immune receptor primarily expressed on myeloid cells, including monocytes, macrophages, and dendritic cells. Its role in immune regulation has become a significant area of research due to its potential implications in various diseases, including autoimmune disorders, infections, and cancer. CD300a is known to interact with phosphatidylserine and other ligands, thereby influencing cell signaling pathways involved in immune responses. Recent studies have highlighted its ability to modulate the activation and differentiation of immune cells, suggesting that CD300a may serve as a critical regulator of immune homeostasis. The development of recombinant CD300a protein allows researchers to investigate its biological functions in detail and explore its potential as a therapeutic target. By studying this protein, scientists aim to elucidate the mechanisms underlying its immunoregulatory functions, which may lead to novel strategies for manipulating immune responses in various pathological contexts. Furthermore, understanding CD300a's signaling pathways could open new avenues for the design of interventions to enhance anti-tumor immunity or mitigate excessive inflammatory responses. Overall, research on recombinant CD300a protein represents a promising frontier in the field of immunology, with implications for advancing therapeutic approaches in immune-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US