Analytical Data
-
Gene name
BRF2
- Application
-
Alternative Names
BRF2; Butyrate response factor 2; C3H1 type-like 2; EGF response factor 2; EGF-response factor 2; ERF 2; ERF-2; ERF2; Protein TIS11D; RNF162C; TIS11D
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47974
-
Expression Region
1-494aa
-
AA Sequence
MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP
-
Molecular Weight
71.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRF2, or BRF2/SLBP complex, is an essential protein involved in the regulation of gene expression through its role in mRNA processing and stability. It primarily functions as a part of the RNA polymerase II machinery, coordinating the transcription and maturation of non-coding RNAs and mRNAs. Recent studies have highlighted the importance of BRF2 in various cellular processes, including cell proliferation, differentiation, and response to stress, linking it to several biological pathways and diseases, including cancer. The specificity of BRF2 interactions with various RNA and protein partners makes it a vital factor in maintaining cellular homeostasis. Moreover, alterations in BRF2 expression or function have been implicated in several disorders, underscoring the protein's potential as a therapeutic target. Research into the structure and function of BRF2 recombinant proteins is crucial for understanding their mechanistic roles in transcriptional regulation and cellular physiology. By elucidating the biochemical properties of BRF2, scientists aim to uncover novel insights into the regulatory networks governing gene expression and to identify potential intervention strategies for diseases linked to BRF2 dysfunction.
