Cat: PA1000-3900

Recombinant Human PVRL4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PVRL4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PVRL4;LNIR;Nectin-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96NY8

  • Expression Region

    32-349aa

  • AA Sequence

    GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELAL LHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVST FPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSV TWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLL QDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYN WTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVD VLDPQEDSGKQVDLVSAS

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PVRL4, also known as Poliovirus Receptor-Like 4, is a member of the immunoglobulin superfamily that has gained significant attention in recent years due to its potential roles in various physiological and pathological processes, particularly in cancer biology. Research indicates that PVRL4 can influence tumor progression and immune evasion, making it a potential target for therapeutic interventions. Expression of PVRL4 has been reported in various human tissues, and its upregulation has been associated with poor prognosis in several types of cancers, including breast and lung cancer. Furthermore, PVRL4 interacts with cell adhesion molecules, which suggests its involvement in cellular signaling pathways that govern cancer cell behavior. Understanding the mechanisms by which PVRL4 contributes to tumorigenesis may provide insights into novel strategies for cancer therapy, as well as improve the efficacy of existing treatments. Given its prominence in immune modulation and oncogenesis, research into PVRL4-recombinant proteins is crucial for elucidating its function and exploring its potential as a biomarker or therapeutic target in oncology. This highlights the need for comprehensive studies, including structural analysis and functional assays, to fully characterize PVRL4's characteristics and interactions at the molecular level, ultimately leading to advancements in targeted cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US