Cat: PA2000-1773

Recombinant E.coli acpS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    acpS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    acpS;dpj;Holo-[acyl-carrier-Protein] synthase

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P63471

  • Expression Region

    1-119aa

  • AA Sequence

    MIVGHGIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISHSGNYAQASVILEEEK

  • Molecular Weight

    20.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACP S (acyl carrier protein S) is a crucial component in the fatty acid biosynthesis pathway across various organisms, including bacteria, plants, and animals. As a fundamental player in the synthesis of fatty acids, ACP S is involved in the transport of acyl groups and interacts with various enzymes that facilitate the elongation and modification of fatty acid chains. Understanding the structure and function of ACP S is critical for elucidating lipid metabolism and cellular energy storage mechanisms. Recent studies have highlighted the significance of ACP S in the development of antibiotic resistance, as certain bacteria depend on fatty acids for membrane integrity and virulence. Additionally, recombinant ACP S proteins are being explored for potential applications in biotechnology, such as the production of biofuels and bio-based chemicals through engineered metabolic pathways. The recombination of ACP S allows researchers to investigate its biochemical properties, interaction with ligands, and its role in various metabolic processes. Furthermore, unraveling the mechanism of ACP S can lead to the design of novel inhibitors that target fatty acid synthesis in pathogenic bacteria, providing a promising avenue for developing new antimicrobial agents. Consequently, the study of recombinant ACP S not only deepens our understanding of fundamental biological processes but also holds significant implications for health and sustainability in the context of food security and energy resources.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US