Analytical Data
-
Gene name
BRSK2
- Application
-
Alternative Names
BRSK2; C11orf7; PEN11B; SADA; STK29; HUSSY-12; Serine/threonine-Protein kinase BRSK2; EC 2.7.11.1; Brain-selective kinase 2; EC 2.7.11.26
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IWQ3
-
Expression Region
1-170aa
-
AA Sequence
MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRSK2, also known as Brain-specific kinase 2, is a serine/threonine kinase that plays a crucial role in cellular signaling, particularly in the nervous system. It is part of the AMP-activated protein kinase (AMPK) family, which is involved in regulating cellular energy homeostasis and various metabolic processes. Research on BRSK2 has gained significant attention due to its potential implications in neurobiology and neurodegenerative diseases. Its activity influences neuronal survival, differentiation, and synaptic plasticity, making it a key player in brain function. Furthermore, aberrations in BRSK2 expression or function have been linked to conditions such as Alzheimer's disease and other forms of dementia, highlighting its importance in understanding the molecular mechanisms underlying these disorders. Investigating BRSK2 through the production and characterization of recombinant proteins allows researchers to explore its enzymatic properties, interaction partners, and regulatory mechanisms in greater detail. This research may pave the way for novel therapeutic strategies aimed at modulating BRSK2 activity, thereby offering potential treatment avenues for neurodegenerative diseases and enhancing our understanding of brain health. As such, BRSK2 represents a vital target for ongoing studies in both basic and applied neuroscience research.
