Analytical Data
-
Gene name
ASIP
- Application
-
Alternative Names
ASIP;AGTI;AGTIL;ASP;Agouti-signaling Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42127
-
Expression Region
23-132aa
-
AA Sequence
HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
-
Molecular Weight
19.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASIP (Agouti Signaling Protein) is a vital protein involved in pigmentation regulation and energy homeostasis. It plays a critical role in the modulation of melanin synthesis in melanocytes, influencing coat color and, consequently, impacting camouflage and mating strategies in various species. Research into ASIP has gained momentum due to its broader implications in understanding obesity and metabolic disorders, as its pathway intersects with the melanocortin system, which regulates appetite and energy expenditure. Understanding the structure and function of ASIP through recombinant protein studies has become increasingly important. Recombinant ASIP offers a powerful tool for elucidating its biological mechanisms, investigating its interactions with other proteins, and developing potential therapeutic approaches for obesity and related metabolic conditions. Additionally, the study of ASIP's role in pigmentation has implications for fields ranging from cosmetic science to evolutionary biology. With advancements in biotechnology, researchers are now able to produce ASIP in various expression systems, enabling the detailed characterization of its structure-function relationship. This ongoing research not only enhances our understanding of fundamental biological processes but also paves the way for innovative applications in both health and industry, making the study of ASIP-recombinant proteins a crucial area of focus in biomedical research.











