Analytical Data
-
Gene name
BRUNOL5
- Application
-
Alternative Names
CUGBP Elav-like family member 5. CELF-5. Bruno-like Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6W0
-
Expression Region
1-402aa
-
AA Sequence
MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEPDCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLETRS
-
Molecular Weight
69.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRUNOL5, a member of the BRUNOL family of RNA-binding proteins, has garnered significant attention in recent years due to its pivotal role in gene regulation and its association with various cellular processes. Originally characterized for its involvement in the post-transcriptional regulation of mRNAs, BRUNOL5 has been implicated in the modulation of splicing, stability, andtranslation efficiency of target transcripts, making it crucial for maintaining cellular homeostasis. Research indicates that BRUNOL5 is particularly important in neural development and synaptic function, suggesting its potential impact in neurodevelopmental disorders. Moreover, recent studies have identified BRUNOL5 as a key player in stress responses and cellular adaptation mechanisms, highlighting its relevance in cancer biology and pathophysiological conditions. The comprehension of BRUNOL5's molecular mechanisms and its interaction with other cellular factors is vital for elucidating its contributions to human health and disease. This has spurred interest in exploring BRUNOL5 as a therapeutic target or biomarker, emphasizing the need for extensive research to unravel its complex regulatory roles and therapeutic potential.











