Analytical Data
-
Gene name
SARM1
- Application
-
Alternative Names
SARM1；KIAA0524；SAMD2；SARM；NAD(+) hydrolase SARM1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6SZW1
-
Expression Region
559-702aa
-
AA Sequence
GDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR
-
Molecular Weight
18.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SARM1 (sterile α and HEAT-repeat-containing protein 1) is a crucial protein involved in the regulation of neuronal degeneration and cellular stress responses. It is a member of the Toll-like receptor (TLR) family, playing a significant role in mediating neuroinflammatory processes and promoting axonal degeneration following nerve injury. The activation of SARM1 leads to the depletion of NAD+ (nicotinamide adenine dinucleotide), resulting in energy failure and subsequent neuronal death. This mechanism has garnered significant interest in the fields of neurobiology and regenerative medicine, as inhibiting SARM1 activity could potentially provide therapeutic benefits for neurodegenerative diseases and peripheral nerve injuries. Research into recombinant SARM1 protein has allowed for a better understanding of its structure-function relationships, facilitating investigations into its signaling pathways and interactions with cellular partners. Moreover, the recombinant protein is instrumental for in vitro studies, enabling scientists to explore the effects of SARM1 modulation and to screen for small-molecule inhibitors that may have neuroprotective properties. Ongoing studies aim to unravel the specific mechanisms by which SARM1 contributes to neuronal pathology, providing a foundation for future therapeutic strategies targeting SARM1 and its associated pathways.
