Analytical Data
-
Gene name
PNPLA4
- Application
-
Alternative Names
Calcium-independent phospholipase A2-eta;iPLA2-eta;EC 3.1.1.4;Protein GS2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41247
-
Expression Region
1-253 aa
-
AA Sequence
MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE
-
Molecular Weight
29.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PNPLA4 (Patatin-like phospholipase domain-containing protein 4) is a member of the patatin-like phospholipase family, which is involved in various lipid metabolism processes. Research on PNPLA4 has gained attention due to its potential role in lipid droplet metabolism and association with certain diseases, including obesity and diabetes. Recent studies have identified PNPLA4 as crucial in the regulation of triglyceride levels and fatty acid release, highlighting its importance in energy homeostasis. Genetic variations in the PNPLA4 gene have been linked to altered lipid profiles and increased risk of metabolic disorders, suggesting that it may serve as a therapeutic target for conditions related to dyslipidemia. The recombinant protein of PNPLA4 is produced to facilitate detailed biochemical and functional analyses, allowing researchers to explore its enzymatic activity, substrate specificity, and interactions with other cellular components. By utilizing recombinant technology, scientists aim to elucidate the biological mechanisms through which PNPLA4 operates, paving the way for potential interventions in metabolic diseases and enhancing our understanding of lipid metabolism.











